PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013585517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 207aa    MW: 23703.9 Da    PI: 10.1461
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013585517.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-162572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l +++  +G g W+++a+  g++Rt+k+c++rw++yl
   XP_013585517.1 25 KGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 72
                     79********************************************97 PP

2Myb_DNA-binding55.41.4e-1778121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+++++++lG++ W++Ia++++ gRt++++k++w++
   XP_013585517.1  78 RGNITAEEQLLIIQLHAKLGNR-WSKIAKYLP-GRTDNEIKNFWRT 121
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9012072IPR017930Myb domain
SuperFamilySSF466891.16E-2923119IPR009057Homeodomain-like
SMARTSM007173.2E-122474IPR001005SANT/Myb domain
PfamPF002495.2E-152572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-222679IPR009057Homeodomain-like
CDDcd001678.01E-92772No hitNo description
PROSITE profilePS5129424.65273127IPR017930Myb domain
SMARTSM007174.9E-1677125IPR001005SANT/Myb domain
PfamPF002493.5E-1678121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2480126IPR009057Homeodomain-like
CDDcd001672.14E-1282121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MDKKKTGIRK ERIPAQKEEE GTVRKGPWTM EEDLILFNYI LNHGEGLWNS VAKASGLKRT  60
GKSCRLRWLN YLRPDVRRGN ITAEEQLLII QLHAKLGNRW SKIAKYLPGR TDNEIKNFWR  120
TKIQRHVKFS SSVNTINTRH CSGNSQSSVI TATDQGSSSK GFDMAESLIS PATTTTSFHM  180
MEQSNDSYWN VEDLWPLQLL NGDHQVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-282512727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00324DAPTransfer from AT3G01530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585517.11e-155PREDICTED: transcription factor MYB57-like
SwissprotQ9SSA11e-112MYB57_ARATH; Transcription factor MYB57
TrEMBLA0A0D3CND01e-155A0A0D3CND0_BRAOL; Uncharacterized protein (Fragment)
STRINGBra039108.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01530.11e-113myb domain protein 57